PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_014515-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 444aa    MW: 48795.1 Da    PI: 5.0295
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_014515-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.2e-174895148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEde+lv++++  G g+W++ ++  g+ R++k+c++rw +yl
    NNU_014515-RA 48 KGRWTAEEDEILVKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 95
                     79******************************99************97 PP

2Myb_DNA-binding54.42.8e-17101146148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE++l+++++  lG++ W++Ia +++ gRt++++k++w+++l
    NNU_014515-RA 101 RGNITPEEEDLIIKLHSALGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 146
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-223998IPR009057Homeodomain-like
PROSITE profilePS5129417.2144395IPR017930Myb domain
SuperFamilySSF466892.16E-2945142IPR009057Homeodomain-like
SMARTSM007178.7E-134797IPR001005SANT/Myb domain
PfamPF002498.5E-154895IPR001005SANT/Myb domain
CDDcd001673.61E-95095No hitNo description
PROSITE profilePS5129426.20396150IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2599150IPR009057Homeodomain-like
SMARTSM007178.1E-17100148IPR001005SANT/Myb domain
PfamPF002491.8E-15101146IPR001005SANT/Myb domain
CDDcd001674.06E-11105146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
LNPTPHFNIH RHIHNLAGSS HHESRQTSLS LCLEMGRAPC CEKVGLKKGR WTAEEDEILV  60
KYIQANGEGS WRSLPKNAGL LRCGKSCRLR WINYLRSDLK RGNITPEEED LIIKLHSALG  120
NRWSLIAGHL PGRTDNEIKN YWNSHLSRRI HSFRRPNSDA LPIVMDLVKM GGGRKRKGGR  180
TSRSAMKKIN SGFNINPSKG DVSTKKPEKA GCGEGGSLLT PTTLEKVSLP SATIGINGEE  240
NGSTPAVRPA GSYQESGSEI LGPTEESSGG GFRSSGEGET ESVVPRPRED REAEVVVPYE  300
ELDTWMLCSD DNVMAGATLV PDNVLAVSGE RDDGVVMGFS EERESEMVGS NKGTTSDDGE  360
SGVISSYNRE NGEWNSSSSS SITSCFEEEW VDWDWKDVVE GHYKLWEDGE ETLSWLWEGD  420
NCGGECHQVV GADMQESLSA WLLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-23461502105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268044.10.0PREDICTED: myb-related protein P-like
TrEMBLA0A061DT341e-114A0A061DT34_THECC; MYB-like DNA-binding domain protein
STRINGVIT_05s0077g01360.t011e-100(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.14e-75myb domain protein 12